tintypes

Frau mit einer Brosche. Aus dem Album: The Colonial Family Album

Public domain scan of portrait art print, free to use, no copyright restrictions image - Picryl description

[Two Firemen (?) with Axes] - Public domain print

Public domain scan of a composite page, portraits, free to use, no copyright restrictions - Picryl description.

Baby, portrait, Tinytype. Museum of New Zealand collection

Public domain vintage photo from New Zealand archive, 19th century, free to use, no copyright restrictions image - Picryl description.

Älterer Mann. Aus dem Album: The Colonial Family Album

Public domain vintage photo from New Zealand archive, 19th century, free to use, no copyright restrictions image - Picryl description.

Frau trägt einen Schal mit Blumenmuster. Aus dem Album: The Colonial F...

Public domain scan of portrait art print, free to use, no copyright restrictions image - Picryl description

Photo of [Four Pipe Fitters with Tools] - Public domain dedication

A photo of a book with a photo of a family of five, free to use, no copyright restrictions image - Picryl description.

Frau mit Akkordeonklingel

United States Public domain photograph of painting, 19th century, free to use, no copyright restrictions image - Picryl description

[Unbekannter liberianischer Mann im Anzug mit Uhranhänger, Papieren un...

The American Colonization Society was organized in 1817 to resettle African-Americans in Liberia. Forms part of: Ambrotype/Tintype photograph filing series (Library of Congress). Forms part of: American Coloni... Mehr

[Liberianischer Mann in Anzug und Fliege]

The American Colonization Society was organized in 1817 to resettle African-Americans in Liberia. Forms part of: Ambrotype/Tintype photograph filing series (Library of Congress). Forms part of: American Coloni... Mehr

A. J. Cross, Tinytype - Public domain portrait photograph

Photograph shows portrait of Liberian man in suit and tie with hat. The American Colonization Society was organized in 1817 to resettle African Americans in Liberia. Forms part of: Ambrotype/Tintype photograph... Mehr

Das beste Bild von William Hornaday (Vater von W.T.H.) mit etwa 35 Jah...

Photograph shows portrait of William Temple Hornaday, Sr. Transfer; LC Manuscript Division; 1985; (DLC/PP-1985:007). Forms part of: William Temple Hornaday papers, 1866-1975 (Library of Congress). Forms part o... Mehr

Woman, portrait, Tinytype. Museum of New Zealand collection

Public domain photo of portrait art print, 19th century, free to use, no copyright restrictions image - Picryl description.

Woman, portrait, Tinytype. Museum of New Zealand collection

Public domain scan of portrait art print, free to use, no copyright restrictions image - Picryl description

Young woman, Tinytype. Museum of New Zealand collection

Public domain photo of portrait art print, 19th century, free to use, no copyright restrictions image - Picryl description.

Bearded man, Tinytype. Museum of New Zealand collection

Public domain vintage artistic photograph, 19th century, free to use, no copyright restrictions image - Picryl description.

Girl, portrait, Tinytype. Museum of New Zealand collection

Public domain vintage photo from New Zealand archive, free to use, no copyright restrictions image - Picryl description

[Sitzender Mann demonstriert vertikales Schiebefenstermodell]

Public domain photograph - 19th-century male studio portrait photograph, free to use, no copyright restrictions image - Picryl description

[Two Plasterers Leaning on a Railing]

A photo of two men standing in a red box, free to use, no copyright restrictions image - Picryl description.

[Sterrup Branch Plantation, Bishopville, S.C., zum 75. Geburtstag von ...

Reference copy in LOT 11334. Exhibited: "Only Skin Deep" at the International Center of Photography, New York City, N.Y., 2003-2004.

[Sterrup Branch Plantation, Bishopville, S.C., zum 75. Geburtstag von ...

Picryl description: Public domain image of a victorian era building, victorian house, 19th century architecture, free to use, no copyright restrictions.

[Abraham Lincoln, halblanges Porträt, mit Blick nach links]

Photo shows Abraham Lincoln in an image that was widely reproduced on presidential campaign ribbins in 1860. Lincoln reportedly liked the photograph and often signed prints for admirers. (Source: Ostendorf, p. ... Mehr

[Zwei Stuckateure lehnen an einem Geländer]

Unknown Public domain reproduction of artwork in Metropolitan Museum of Art, free to use, no copyright restrictions image - Picryl description

[Zwei junge Männer, einer sitzend und einer stehend, mit Tischlerwerkz...

Public domain reproduction of artwork in Metropolitan Museum of Art, free to use, no copyright restrictions image - Picryl description

[Zwei Klempner mit Rohr, Rohrschneider und Werkzeugkasten]

Public domain reproduction of artwork in Metropolitan Museum of Art, free to use, no copyright restrictions image - Picryl description

[Portrait of Corp. Charles W. Chase, Company C, 7th Vermont Infantry]

Public domain scan of portrait art print, free to use, no copyright restrictions image - Picryl description

[Porträt eines Bundessoldaten]

Picryl description: Public domain image of a uniform, military personnel, armed forces, free to use, no copyright restrictions.

[Porträt eines Bundesoffiziers]

Public domain portrait photograph, free to use, no copyright restrictions image - Picryl description

[Two Tinsmiths], Tinytype - Public domain museum object photo

A black and white photo of two men standing next to each other, 19th century, free to use, no copyright restrictions image - Picryl description.

[Presidential Campaign Medal with portraits of Abraham Lincoln and Han...

A gold medal with a portrait of abraham lincoln, North and Central America, free to use, no copyright restrictions image - Picryl description

Portrait photo of [Unidentified deceased child], Tinytype

Case: Leather; oval and scroll design. Gift; Tom Liljenquist; 2012; (DLC/PP-2012:127). Forms part of: Liljenquist Family Collection of Civil War Photographs (Library of Congress). Forms part of: Ambrotype/Tint... Mehr

[Carpenter with Ladder, Hammer, Level, and Toolbox]

A photo of a man in a leather case with a book in it, free to use, no copyright restrictions image - Picryl description.

[Zwei junge Männer im Freien, einer sitzend, der andere auf dem Arm de...

Unknown (American) Public domain reproduction of artwork in Metropolitan Museum of Art, free to use, no copyright restrictions image - Picryl description

[Stonecutter with Child], Tinytype, Metropolitan Museum of Art

Unknown (American) Public domain reproduction of artwork in Metropolitan Museum of Art, free to use, no copyright restrictions image - Picryl description

[Carpenter with Saw, Hammer, and Jointer]

A portrait of a man in a leather vest and hat, 19th century, free to use, no copyright restrictions image - Picryl description.

[Four Workmen Holding Different Tools: Square, Hatchet, Wood Plane, an...

A group of four men sitting on a chair, 19th century, free to use, no copyright restrictions image - Picryl description.

[Porträt eines Sergeanten, USA]

Public domain photograph - military portrait, armed forces officer, leader, commander, 19th century, free to use, no copyright restrictions image - Picryl description

Chimney Scaffold, 19th century - Public domain drawing

Picryl description: Public domain image of an architectural drawing from the Metropolitan Museum of Art, free to use, no copyright restrictions.

[Unbekanntes Mädchen in einem karierten Kleid mit Spitzenkragen und Sc...

Source unknown. Forms part of: Ambrotype/Tintype photograph filing series (Library of Congress). Accession no. PR 06 CN 1096, no. 2

[Seitenansicht eines hemdsärmligen Mannes, der eine Metallstange schie...

[Zwei Dachdecker arbeiten auf einem Gebäude]

Public domain photograph of 3d object, free to use, no copyright restrictions image - Picryl Description.

[Dreiviertel-Gesichtsporträt eines Mannes mit Bart]

Photograph showing a portrait of an unidentified man. Gift, Fred Lockley, 1930.

Portrait of a baby - Public domain portrait print

Public domain vintage photo from New Zealand archive, 19th century, free to use, no copyright restrictions image - Picryl description.

[Man with a Bucket on his Arm] - Public domain dedication. Metropolita...

Unknown (American) Public domain reproduction of artwork in Metropolitan Museum of Art, free to use, no copyright restrictions image - Picryl description

[Porträt eines Bundessoldaten]

Public domain photograph - United States during American Civil War, free to use, no copyright restrictions image - Picryl description

[Zwei Männer in Umarmung, einer sitzt auf dem anderen & # 39; s Schoß]

Unknown (American) Public domain reproduction of artwork in Metropolitan Museum of Art, free to use, no copyright restrictions image - Picryl description

[Sechs Arbeiter mit verschiedenen Handelswerkzeugen: Pinsel, Eimer, Gl...

Public domain photograph of 3d object, free to use, no copyright restrictions image - Picryl description.

[Carpenter or Cabinetmaker Standing Before a Sign Advertising His Trad...

A man standing in front of a table with a large knife, free to use, no copyright restrictions image - Picryl description.

[Porträt von Pvt. William W. Heath, Company H, 4th Vermont Infantry, U...

Pvt. Heath was killed in Wilderness, May 5, 1864. Public domain photograph - military portrait, armed forces officer, leader, commander, 19th century, free to use, no copyright restrictions image - Picryl description

[Zwei Maurer, die Ziegel und Kellen halten]

Public domain reproduction of artwork in Metropolitan Museum of Art, free to use, no copyright restrictions image - Picryl description

[Mason (?) Mit Kelle und Vorschlaghammer]

Public domain reproduction of artwork in Metropolitan Museum of Art, free to use, no copyright restrictions image - Picryl description

[Porträt von Pvt. George F. Norris, Company K, 5th Vermont Infantry, U...

Public domain photograph - military portrait, armed forces officer, leader, commander, 19th century, free to use, no copyright restrictions image - Picryl description

[Zwei sitzende junge Männer an den Händen]

Unknown (American) Public domain reproduction of artwork in Metropolitan Museum of Art, free to use, no copyright restrictions image - Picryl description

[Porträt zweier Bundessoldaten]

Public domain photograph - United States during American Civil War, free to use, no copyright restrictions image - Picryl description

[Portrait of a Federal soldier]

Public domain reproduction of portrait art print, free to use, no copyright restrictions image - Picryl description

Portrait of Capt. Murray F. Taylor, C.S.A., aide to General A. P. Hill

Forms part of Selected Civil War photographs, 1861-1865 (Library of Congress) Copy photo made by LC in 1961 of tintype. Credit: Mrs. Lynn W. Franklin, Fredericksburg, Va. American Memory edition timeline. No. 1... Mehr

Portrait of a Federal soldier. American Civil War 1861-1865.

Forms part of Selected Civil War photographs, 1861-1865 (Library of Congress) Copy photo made by LC in 1961 of tintype in collection of Tom Hall, Silver Springs, Md. American Memory edition timeline. No. 1072 C... Mehr

[Unbekannter Mann in freimaurerischen Insignien, einschließlich Stulpe...

Originally in album belonging to Joel B. Clough, Civilian Engineer, United States Military Railroad, 1863 and 1864. Gift; Florence C. Abel; 1961.

[Maler, Zigarre rauchen, Pinsel und Schaber in der Hand]

Picryl description: Public domain vintage artistic photograph, free to use, no copyright restrictions image.

[Präsidentschaftswahlkampfmedaille mit Porträts von Abraham Lincoln un...

Public domain photograph of 3d object, free to use, no copyright restrictions image - Picryl description.

[Two Plumbers in Overalls] - Public domain portrait print

Unknown (American) Public domain reproduction of artwork in Metropolitan Museum of Art, free to use, no copyright restrictions image - Picryl description

[Maler stützt seine Hand auf Lattenzaun]

Unknown (American) Public domain reproduction of artwork in Metropolitan Museum of Art, free to use, no copyright restrictions image - Picryl description

[Porträt des Sgt. James W. Travis, 38. Freiwillige Infanterie von Illi...

Public domain photograph - military portrait, armed forces officer, leader, commander, 19th century, free to use, no copyright restrictions image - Picryl description

[Ganzteiliges Porträt eines Kindes, das inmitten von Trümmern sitzt]

Public domain photograph - Portrait, United States, free to use, no copyright restrictions image - Picryl description

[Gruppe von Männern und Jungen, die am Geländer der Fulton Street Brid...

Public domain reproduction of artwork in Metropolitan Museum of Art, free to use, no copyright restrictions image - Picryl description

[Tischler beim Sägen einer Holzplanke]

Unknown (American) Public domain reproduction of artwork in Metropolitan Museum of Art, free to use, no copyright restrictions image - Picryl description

[Drei Klempner mit Rohren und Werkzeug]

Public domain reproduction of artwork in Metropolitan Museum of Art, free to use, no copyright restrictions image - Picryl description

Chimney Scaffold, 19th century - Public domain dedication. Metropolita...

J. Jeane Public domain reproduction of artwork in Metropolitan Museum of Art, free to use, no copyright restrictions image - Picryl description

[Unidentified woman in hat] / C.C. Cook & Co., 916 Chestnut St., Phila...

Photograph shows young man in suit. Chapin C. Cook listed without occupation at 916 Chestnut St. in McElroy's Philadelphia city directory, 1865; listed in 1870 U.S. Census as boot maker in Providence, Rhode Is... Mehr

James William Liddiard, Tinytype

Public domain vintage photo from New Zealand archive, free to use, no copyright restrictions image - Picryl description

[Two Women and a Child] - Public domain portrait print

Public domain reproduction of artwork in Metropolitan Museum of Art, free to use, no copyright restrictions image - Picryl description

[Gipser mit Falke und Kelle]

Public domain image of a military forces, uniform, officer, military commander, European armies, free to use, no copyright restrictions -Picryl description

Woman, portrait, Tinytype. Museum of New Zealand collection

Public domain photo of portrait art print, 19th century, free to use, no copyright restrictions image - Picryl description.

[Zwei Männer in Boxposition, ein dritter Mann, der die Form eines Mann...

Public domain photograph - 19th-century male studio portrait photograph, free to use, no copyright restrictions image - Picryl description

[Zwei rauchende Männer, einer sitzt auf dem anderen & # 39; s Schoß]

Unknown (American) Public domain photograph - 19th-century studio portrait photo, free to use, no copyright restrictions image - Picryl description

[Sitzender Mann demonstriert vertikales Schiebefenstermodell]

Unknown (American) Public domain photograph - 19th-century male studio portrait photograph, free to use, no copyright restrictions image - Picryl description

[Zwei Gewerkschaftssoldaten, die sich an Händen und Armen umeinander h...

Unknown (American) Public domain reproduction of artwork in Metropolitan Museum of Art, free to use, no copyright restrictions image - Picryl description

[Workman with Tool Box] - Victorian era public domain image

Unknown (American) Public domain reproduction of artwork in Metropolitan Museum of Art, free to use, no copyright restrictions image - Picryl description

Portrait of two Federal soldiers. American Civil War 1861-1865.

Forms part of Selected Civil War photographs, 1861-1865 (Library of Congress) Copy photo made by LC in 1961 of tintype in collection of John Rawls, Vienna, Va. American Memory edition timeline. No. 1061 Credit ... Mehr

Woman, portrait, Tinytype. Museum of New Zealand collection

Public domain vintage photo from New Zealand archive, 19th century, free to use, no copyright restrictions image - Picryl description.

Porträt des Pvt. Levi Miller, Ohio Regiment, USA

Forms part of Selected Civil War photographs, 1861-1865 (Library of Congress) Copy photo made by LC in 1961 of tintype. Credit: Lloyd Ostendorf, Dayton, Ohio. American Memory edition timeline. No. 1089 Credit l... Mehr

[Young man in smock] - Public domain portrait photograph

Photograph showing a portrait of a young man wearing a smock and a hat. Gift, Fred Lockley, 1930.

[Carpenter Holding a Bag of Tools and a Square]

A photo of a man in a red velvet case, free to use, no copyright restrictions image - Picryl description.

Portrait photo of [Unidentified girl in plaid blouse]

Forms part of: Ambrotype/Tintype photograph filing series (Library of Congress). Former accession number: PR 06 CN 908, no. 1048

[Mann als Mönch mit nach hinten geneigtem Kopf, als würde er singen]

Public domain photograph - Portrait, United States, free to use, no copyright restrictions image - Picryl description

[Porträt von John Miller Dummerston, Company K, 9th Vermont Infantry, ...

Picryl description: Public domain vintage artistic photograph, free to use, no copyright restrictions image.

[Woman in bonnet, bust portrait] Cartes de visite

Photograph showing a portrait of an unidentified woman. Gift, Fred Lockley, 1930.

[Stonecutter with Child], Tinytype, Metropolitan Museum of Art

Public domain photograph of 3d object, free to use, no copyright restrictions image - Picryl Description.

[Maler in mit Farbe besprühten Overalls mit Pinsel und Farbeimer]

Picryl description: Public domain image of painting, 19th century, free to use, no copyright restrictions

[Vier Arbeiter mit verschiedenen Werkzeugen: Quadrat, Beil, Holzhobel ...

Public domain photograph of 3d object, free to use, no copyright restrictions image - Picryl description.

[Zwei Jungen, einer sitzend, einer stehend]

Photograph showing a studio portrait of two unidentified boys. Gift, Fred Lockley, 1930.

[Two Men Reviewing Plans] - Public domain portrait print

Public domain photo of 19th-century portrait photograph, free to use, no copyright restrictions image - Picryl description

[Carpenter with Square], Tinytype, Metropolitan Museum of Art

Unknown (American) Public domain reproduction of artwork in Metropolitan Museum of Art, free to use, no copyright restrictions image - Picryl description

[Zwei junge Männer sitzen mit ihren Armen umeinander]

Unknown (American) Public domain photograph - 19th-century studio portrait photo, free to use, no copyright restrictions image - Picryl description

[Familie posiert auf der Bow Bridge, Central Park, New York]

Unknown (American) Public domain reproduction of artwork in Metropolitan Museum of Art, free to use, no copyright restrictions image - Picryl description

[Boy, bust portrait], Tinytype - Public domain portrait photograph

Photograph showing a portrait of an unidentified boy. Public domain photograph - Portrait, United States, free to use, no copyright restrictions image - Picryl description

[Male, half-length, seated] - Public domain portrait photograph

Photograph showing a portrait of an unidentified man. Gift, Fred Lockley, 1930.

Portrait of New York Zouaves. American Civil War 1861-1865.

Forms part of Selected Civil War photographs, 1861-1865 (Library of Congress) Copy photo made by LC in 1961 of a tintype. Credit: Mr. G.K. Holmes, Cornwall Bridge, Conn. American Memory edition timeline. No. 11... Mehr

Portrait of a sergeant, U.S.A.. American Civil War 1861-1865.

Forms part of Selected Civil War photographs, 1861-1865 (Library of Congress) Copy photo made by LC in 1961 of a tintype in collection of Marius B. Péladeau. American Memory edition timeline. No. 1097 Credit li... Mehr

Porträt des Pvt. Charles H. Halstead, Company A, 52nd Illinois Infantr...

Forms part of Selected Civil War photographs, 1861-1865 (Library of Congress) Copy photo made by LC in 1961 of tintype in collection of Lloyd A. Dunlap, Washington, D.C. American Memory edition timeline. No. 10... Mehr

Portrait photo of [Boy, seated, frontal], Tinytype

Photograph showing a portrait of an unidentified boy. Gift, Fred Lockley, 1930.